Skip to Content
Human Glutathione S transferase omega 1(GSTO1) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Tags & Cell Markers
Uniprot ID : P78417
Species : Human
Former Code :
Alias : RP11-99N20.1 DKFZp686H13163, GSTTLp28, P28, glutathione S-transferase omega 1-1|glutathione transferase omega 1|glutathione-S-transferase like|glutathione-S-transferase omega 1
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 31.2 pg/ml-2000 pg/ml
Sensitivity : 7.8 pg/ml
Antigen Name : glutathione S-transferase omega 1
Abbreviation : GSTO1
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human Glutathione S transferase Mu 2(GSTM2) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P28161
Species : Human
Former Code :
Alias : GST4, GSTM, GSTM2-2, GTHMUS, MGC117303, GST class-mu 2|GST, muscle|S-(hydroxyalkyl)glutathione lyase M2|glutathione S-alkyltransferase M2|glutathione S-aralkyltransferase M2|glutathione S-aryltransf
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates and cell lysates
Detect Range : 0.312 ng/ml-20 ng/ml
Sensitivity : 0.078 ng/ml.
Antigen Name : glutathione S-transferase mu 2 (muscle)
Abbreviation : GSTM2
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human Glutathione S transferase Mu 1(GSTM1) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P09488
Species : Human
Former Code :
Alias : GST1 GSTM1-1 GSTM1a-1a, GSTM1b-1b, GTH4, GTM1 H-B, MGC26563, MU, MU-1 GST class-mu 1|HB subunit 4|S-(hydroxyalkyl)glutathione lyase|glutathione S-alkyltransferase|glutathione S-aralkyltransferas
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 0.47 mU/ml-30 mU/ml
Sensitivity : 0.11 mU/ml.
Antigen Name : glutathione S-transferase mu 1
Abbreviation : GSTM1
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human Glutathione S Transferase Alpha 1 (GSTA1) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : P00390
Abbreviation : GSTA1
Alternative Names : GSTa1; GST2; GSTA1-1; GTH1
Application : ELISA
Range : 62.5-4000 pg/mL
Sensitivity : 27.4 pg/mL
Intra-AssayCV : ?4.8%
Inter-AssayCV : ?9.4%
Recovery : 0.95
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate GSTA1 in samples. An antibody specific for GSTA1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGSTA1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for GSTA1 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GSTA1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : Cytosolic and membrane-bound forms of glutathione S-transferase are encoded by two distinct supergene families. These enzymes function in the detoxification of electrophilic compounds, including carcinogens, therapeutic dr µgs, environmental toxins and products of oxidative stress, by conj µgation with glutathione.GSTa1 encodes a glutathione S-tranferase belonging to the alpha class. The alpha class genes, located in a cluster mapped to chromosome 6, are the most abundantly expressed glutathione S-transferases in liver. In addition to metabolizing bilirubin and certain anti-cancer dr µgs in the liver, the alpha class of these enzymes exhibit glutathione peroxidase activity thereby protecting the cells from reactive oxygen species and the products of peroxidation.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human Glutathione Reductase(GR)ELISA Kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P00390
Species : Human
Former Code : CSB-EL009968HU
Alias : MGC78522,
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 0.625 mU/ml-40 mU/ml
Sensitivity : 0.156 mU/ml.
Antigen Name : glutathione reductase
Abbreviation : GSR
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
803.88 803.88 USD
Human Glutathione peroxidase 7(GPX7) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : Q96SL4
Species : Human
Former Code :
Alias : CL683, FLJ14777, GPX6, NPGPx, glutathione peroxidase 6|non-selenocysteine containing phospholipid hydroperoxide glutathione peroxidase
Product Type : ELISA Kit
Sample Type :
Detect Range : Request Information
Sensitivity : Request Information
Antigen Name : glutathione peroxidase 7
Abbreviation : GPX7
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human Glutathione peroxidase 6(GPX6) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Others
Uniprot ID : P59796
Species : Human
Former Code :
Alias : , glutathione peroxidase 6
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 1.56 mU/ml-100 mU/ml
Sensitivity : 0.39 mU/ml
Antigen Name : glutathione peroxidase 6 (olfactory)
Abbreviation : GPX6
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human Glutathione peroxidase 3(GPX3) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Cancer
Uniprot ID : P22352
Species : Human
Former Code : CSB-EL009868HU
Alias : GPx-P, GSHPx-3, GSHPx-P, extracell µLar glutathione peroxidase|glutathione peroxidase 3
Product Type : ELISA Kit
Sample Type : serum, plasma and tissue homogenates
Detect Range : 15.6 μIU/ml-1000 μIU/ml
Sensitivity : 3.9 ?IU/ml
Antigen Name : glutathione peroxidase 3
Abbreviation : GPX3
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
887.04 887.04 USD
Human Glutathione peroxidase 2(GPX2) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P18283
Species : Human
Former Code :
Alias : GI-GPx, GPRP, GSHPX-GI, GSHPx-2, gastrointestinal glutathione peroxidase 2|glutathione peroxidase 2|glutathione peroxidase-related protein 2
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 25 pg/ml-1600 pg/ml
Sensitivity : 6.25 pg/ml
Antigen Name : glutathione peroxidase 2 (gastrointestinal)
Abbreviation : GPX2
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human Glutathione peroxidase 1(GPX1) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Cancer
Uniprot ID : P07203
Species : Human
Former Code :
Alias : GSHPX1 MGC14399, MGC88245, OTTHUMP00000210766|cell µLar glutathione peroxidase
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 15.6 μU/ml-1000 μU/ml
Sensitivity : 3.9 μU/ml >
>
Antigen Name : glutathione peroxidase 1
Abbreviation : GPX1
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human Glutathione peroxidase (GSH PX) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : N/A
Abbreviation : GPX3
Alternative Names : GPx-P; GSHPx-3; GSHPx-P; extracell µLar glutathione peroxidase|glutathione peroxidase 3
Application : ELISA
Range : 31.25-2000 ?IU/mL
Sensitivity : 15.8 ?lU/mL
Intra-AssayCV : ?4.1%
Inter-AssayCV : ?11.6%
Recovery : 1.01
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate GPX3 in samples. An antibody specific for GPX3 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGPX3 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for GPX3 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GPX3 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview :
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
897.60 897.6 USD
Human Glutaredoxin 2 mitochondrial(GLRX2) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Signal Transduction
Uniprot ID : Q9NS18
Species : Human
Former Code :
Alias : RP11-101E13.4, GRX2, bA101E13.1 bA101E13.1 (GRX2 glutaredoxin (thioltransferase) 2)
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 3.12 pg/ml-200 pg/ml
Sensitivity : 0.78 pg/ml
Antigen Name : glutaredoxin 2
Abbreviation : GLRX2
Protein Biological Process 1 : Transport
Protein Biological Process 2 : Anion transport
Protein Biological Process 3 : Electron transport
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 5-7 working days
803.88 803.88 USD
Human Glutaredoxin 1(GLRX) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Signal Transduction
Uniprot ID : P35754
Species : Human
Former Code :
Alias : GRX, GRX1 MGC117407,
Product Type : ELISA Kit
Sample Type :
Detect Range : Request Information
Sensitivity : Request Information
Antigen Name : glutaredoxin (thioltransferase)
Abbreviation : GLRX
Protein Biological Process 1 : Transport
Protein Biological Process 2 : Anion transport
Protein Biological Process 3 : Electron transport
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 5-7 working days
803.88 803.88 USD
Human Glutamyl tRNA (QRSL1) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : Q9H0R6
Abbreviation : QRSL1
Alternative Names : DKFZp564C1278; FLJ10989; FLJ12189; FLJ13447; GatA;
Application : ELISA
Range : Request Information
Sensitivity : Request Information
Intra-AssayCV : ?6.1%
Inter-AssayCV : ?11.3%
Recovery : 0.98
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate QRSL1 in samples. An antibody specific for QRSL1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyQRSL1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for QRSL1 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of QRSL1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : QRSL1 belongs to the amidase family, similar to glutaminyl-tRNA synthetase. Glutaminyl-tRNA synthetase is a class Ic synthetase and shows several similarities with glutamyl-tRNA synthetase concerning structure and catalytic properties. It is an alpha2 dimer. Glutaminyl-tRNA synthetase is a relatively rare synthetase, found in the cytosolic compartment of eukaryotes, in Escherichia coli and a number of other Gram-negative bacteria, and in Deinococcus radiodurans. In contrast, the pathway to Gln-tRNA in mitochondria, Archaea, Gram-positive bacteria, and a number of other lineages is by misacylation with Glu followed by transamidation to correct the aminoacylation to Gln. A stable glutaminly-adenylate analog, which inhibits GlnRS with a Ki of 1.32 microM, was syntheVolumed and cocrystallized with GlnRS and tRNA2Gln.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human Glutaminyl tRNA synthetase (QARS) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : P47897
Abbreviation : QARS
Alternative Names : GLNRS; PRO2195; glutamine tRNA ligase|glutamine-tRNA synthetase
Application : ELISA
Range : Request Information
Sensitivity : Request Information
Intra-AssayCV : ?4.1%
Inter-AssayCV : ?8.6%
Recovery : 0.97
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate QARS in samples. An antibody specific for QARS has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyQARS present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for QARS is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of QARS bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : Aminoacyl-tRNA synthetases catalyze the aminoacylation of tRNA by their cognate amino acid. Because of their central role in linking amino acids with nucleotide triplets contained in tRNAs, aminoacyl-tRNA synthetases are tho µght to be among the first proteins that appeared in evolution. In metazoans, 9 aminoacyl-tRNA synthetases specific for glutamine (gln), glutamic acid (glu), and 7 other amino acids are associated within a m µLtienzyme complex. Altho µgh present in eukaryotes, glutaminyl-tRNA synthetase (QARS) is absent from many prokaryotes, mitochondria, and chloroplasts, in which Gln-tRNA(Gln) is formed by transamidation of the misacylated Glu-tRNA(Gln). Glutaminyl-tRNA synthetase belongs to the class-I aminoacyl-tRNA synthetase family.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
805.20 805.2 USD
Human Glutaminyl peptide cyclotransferase like protein (QPCTL) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : Q9NXS2
Abbreviation : QPCTL
Alternative Names : FLJ20084; glutaminyl cyclase-like
Application : ELISA
Range : Request Information
Sensitivity : Request Information
Intra-AssayCV : ?5.4%
Inter-AssayCV : ?10.8%
Recovery : 1.02
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate QPCTL in samples. An antibody specific for QPCTL has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyQPCTL present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for QPCTL is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of QPCTL bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : QPCTL, also termed Iso-glutaminyl cyclase catalyzes the intramolec µLar cyclization of N-terminal glutamine residues into pyroglutamic acid with liberation of ammonia and the intramolec µLar cyclization of N-terminal glutamate residues into pyroglutamic acid with liberation of water. Glutaminyl cyclase (QPCT) catalyzes the intramolec µLar cyclization of N-terminal glutamine residues into pyroglutamic acid liberating ammonia. In contrast, the physiological function of the plant QC is less clear. In case of the enzyme from C. papaya, a role in the plant defence against pathogenic microorganisms was s µggested. Putative QCs from other plants were identified by sequence comparisons. The physiological function of these enzymes, however, is still ambiguous.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human Glutaminyl peptide cyclotransferase(QPCT) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : Q16769
Species : Human
Former Code :
Alias : GCT, QC, glutaminyl cyclase
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 0.312 ng/ml-20 ng/ml
Sensitivity : 0.078 ng/ml
Antigen Name : glutaminyl-peptide cyclotransferase
Abbreviation : QPCT
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human Glutaminyl peptide cyclotransferase (QPCT) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : Q16769
Abbreviation : QPCT
Alternative Names : GCT; QC; glutaminyl cyclase
Application : ELISA
Range : 0.156-10 ng/mL
Sensitivity : 0.065 ng/mL
Intra-AssayCV : ?5.2%
Inter-AssayCV : ?9.7%
Recovery : 1.07
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate QPCT in samples. An antibody specific for QPCT has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyQPCT present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for QPCT is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of QPCT bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : QPCT encodes human pituitary glutaminyl cyclase, which is responsible for the presence of pyroglutamyl residues in many neuroendocrine peptides. The amino acid sequence of this enzyme is 86% identical to that of bovine glutaminyl cyclase. The deduced 361-amino acid protein has a calc µLated molec µLar mass of about 41 kD. It contains an N-terminal signal peptide region, several glycosylation and phosphorylation sites, and 2 cysteine residues conserved between the bovine and human enzymes. QPCT shares 86% overall sequence identity with the bovine homolog.Glutaminyl cyclase expression was upreg µLated in the cortices of individuals with Alzheimer disease and correlated with the appearance of pE-modified amyloid beta.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human Glutamine rich protein 2 (QRICH2) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : Q9H0J4
Abbreviation : QRICH2
Alternative Names : DKFZp434P0316;
Application : ELISA
Range : Request Information
Sensitivity : Request Information
Intra-AssayCV : ?5.3%
Inter-AssayCV : ?10.7%
Recovery : 0.88
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate QRICH2 in samples. An antibody specific for QRICH2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyQRICH2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for QRICH2 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of QRICH2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : RICH2 contains 1 CARD domain. Glutamine is one of the 20 amino acids encoded by the standard genetic code. It is not an essential amino acid. Its side-chain is an amide formed by replacing the side-chain hydroxyl of glutamic acid with an amine functional group. Therefore, it can be considered the amide of glutamic acid. Caspase activation and recruitment domains (CARDs), are interaction motifs found in a wide array of proteins, typically those involved in processes relating to inflammation and apoptosis. These domains mediate the formation of larger protein complexes via direct interactions between individual CARDs. CARD domains are found on a strikingly wide range of proteins, including helicases, kinases, mitochondrial proteins, caspases, and other cytoplasmic factors.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human Glutamine rich protein 1 (QRICH1) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : Q2TAL8
Abbreviation : QRICH1
Alternative Names : FLJ20259; MGC131838; OTTHUMP00000210560
Application : ELISA
Range : Request Information
Sensitivity : Request Information
Intra-AssayCV : ?5.4%
Inter-AssayCV : ?10.8%
Recovery : 0.9
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate QRICH1 in samples. An antibody specific for QRICH1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyQRICH1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for QRICH1 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of QRICH1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : QRICH1 contains 1 CARD domain. Glutamine is one of the 20 amino acids encoded by the standard genetic code. It is not an essential amino acid. Its side-chain is an amide formed by replacing the side-chain hydroxyl of glutamic acid with an amine functional group. Therefore, it can be considered the amide of glutamic acid. Caspase activation and recruitment domains (CARDs), are interaction motifs found in a wide array of proteins, typically those involved in processes relating to inflammation and apoptosis. These domains mediate the formation of larger protein complexes via direct interactions between individual CARDs. CARD domains are found on a strikingly wide range of proteins, including helicases, kinases, mitochondrial proteins, caspases, and other cytoplasmic factors.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human Glutamine dependent NAD (NADSYN1) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : Q6IA69
Abbreviation : NADSYN1
Alternative Names : FLJ10631; FLJ36703; FLJ40627; glutamine-dependent NAD synthetase
Application : ELISA
Range : Request Information
Sensitivity : Request Information
Intra-AssayCV : ?5.3%
Inter-AssayCV : ?7.9%
Recovery : 1.01
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate NADSYN1 in samples. An antibody specific for NADSYN1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyNADSYN1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for NADSYN1 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of NADSYN1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview :
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
805.20 805.2 USD
Human Glutamine and serine rich protein 1 (QSER1) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : Q2KHR3
Abbreviation : QSER1
Alternative Names : FLJ21924;
Application : ELISA
Range : Request Information
Sensitivity : Request Information
Intra-AssayCV : ?5.2%
Inter-AssayCV : ?9.7%
Recovery : 0.92
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate QSER1 in samples. An antibody specific for QSER1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyQSER1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for QSER1 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of QSER1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : QSER1 protein contains two high conserved domains found not only in QSER1 but also in other protein products. This property was conserved from the human QSER1 to the Coelacanth QSER1. M µLtiple conserved nuclear localization signals were also predicted within the QSER1 protein by pSORT. Predictions of the QSER1 protein structure indicate that the protein contains many alpha helices. NCBI cBLAST predicted structural similarity between the QSER1 protein and the Schizosaccharomyces pombe (fission yeast) RNA Polymerase II A chain. The two regions of similarity occur between amino acids 56-194 and 322-546. This first region (56-194) is a reg µLatory region in both the human and yeast RNA Polymerase II containing m µLtiple repeats of the sequence YSPTSPSYS.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human glutamic oxaloacetic transaminase 2 mitochondrial (aspartate aminotransferase 2) (GOT2) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Signal Transduction
Uniprot ID : P00505
Species : Human
Former Code : CSB-EL009681HU
Alias : FLJ40994, KAT4, KATIV, mitAAT, aspartate aminotransferase 2|kynurenine aminotransferase IV
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 0.156 mU/ml-10 mU/ml
Sensitivity : 0.039mU/ml
Antigen Name : glutamic-oxaloacetic transaminase 2, mitochondrial (aspartate aminotransferase 2)
Abbreviation : GOT2
Protein Biological Process 1 : Transport
Protein Biological Process 2 :
Protein Biological Process 3 : Lipid transport
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
887.04 887.04 USD
Human glutamic acid decarboxylase GAD ELISA Kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Neuroscience
Uniprot ID : Q99259
Species : Human
Former Code : CSB-EL009159HU
Alias : FLJ45882, GAD, SCP, glutamate decarboxylase 1
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 0.312 ng/ml-20 ng/ml
Sensitivity : 0.078 ng/ml
Antigen Name : glutamate decarboxylase 1 (brain, 67kDa)
Abbreviation : GAD1
Protein Biological Process 1 : Neurobiology
Protein Biological Process 2 :
Protein Biological Process 3 : Neurotransmitter biosynthesis
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
887.04 887.04 USD
Human glutamic acid decarboxylase 65(GAD65) antibody (IgG) ELISA Kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Neuroscience
Uniprot ID :
Species : Human
Former Code :
Alias :
Product Type : ELISA Kit
Sample Type : serum
Detect Range :
Sensitivity :
Antigen Name : glutamic acid decarboxylase 65(GAD65) antibody (IgG)
Abbreviation : GAD65 antibody (IgG)
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
0.01 0.01 USD
Human Glutamic acid decarboxylase 65 IgG antibody (GAD65 Ab IgG) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : N/A
Abbreviation : GAD65-Ab-IgG
Alternative Names : N/A
Application : ELISA
Range : Detection antibody
Sensitivity : Request Information
Intra-AssayCV : ?4.6%
Inter-AssayCV : ?7.3%
Recovery : 0.99
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Competitive ELISA
Analysis Method?? : Qualitative
Test principle : This assay employs the competitive enzyme immunoassay technique. The microtiter plate provided in this kit has been pre-coated with an antibody specific to GAD65-Ab-IgG. Standards or samples are then added to the appropriate microtiter plate wells with a Horseradish Peroxidase (HRP)-conj µgated GAD65-Ab-IgG and incubated. The competitive inhibition reaction is launched between with HRP labeled GAD65-Ab-IgG and unlabeled GAD65-Ab-IgG with the antibody. A substrate solution is added to the wells and the color develops in opposite to the amount of GAD65-Ab-IgG in the sample. The color development is stopped and the intensity of the color is measured.
Product Overview :
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
805.20 805.2 USD
Human Glutamic acid decarboxylase 65 (GAD65) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : Q05329
Abbreviation : GAD2
Alternative Names : RP11-420F12.2; GAD65; MGC161605; MGC161607; Glutamate decarboxylase-2 (pancreas)|glutamate decarboxylase 2
Application : ELISA
Range : 0.78-50 ng/mL
Sensitivity : 0.38 ng/mL
Intra-AssayCV : ?5.3%
Inter-AssayCV : ?9.3%
Recovery : 1.01
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate GAD2 in samples. An antibody specific for GAD2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGAD2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for GAD2 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GAD2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview :
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
805.20 805.2 USD
Human glutamic acid decarboxylase (GAD) autoantibody (IgM) ELISA Kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Others
Uniprot ID :
Species : human
Former Code :
Alias :
Product Type : ELISA Kit
Sample Type : serum
Detect Range :
Sensitivity :
Antigen Name : glutamic acid decarboxylase(GAD) autoantibody (IgM)
Abbreviation :
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
0.01 0.01 USD
Human Glutamate cysteine ligase regulatory subunit(GCLM) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P48507
Species : Human
Former Code :
Alias : RP4-561L24.2, GLCLR, GSC light chain|glutamate-cysteine ligase (gamma-glutamylcysteine synthetase), reg µLatory (30.8kD)|glutamate-cysteine ligase reg µLatory protein
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 62.5 pg/ml-4000 pg/ml
Sensitivity : 15.6 pg/ml.
Antigen Name : glutamate-cysteine ligase, modifier subunit
Abbreviation : GCLM
Protein Biological Process 1 : Biosynthesis/Metabolism
Protein Biological Process 2 : Amino-acid biosynthesis and metabolism
Protein Biological Process 3 : Glutathione biosynthesis
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 5-7 working days
803.88 803.88 USD
Human Glutamate cysteine ligase catalytic subunit(GCLC) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P48506
Species : Human
Former Code :
Alias : GCL, GCS, GLCL, GLCLC, gamma-glutamylcysteine synthetase
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 0.156 ng/ml-10 ng/ml
Sensitivity : 0.039 ng/ml.
Antigen Name : glutamate-cysteine ligase, catalytic subunit
Abbreviation : GCLC
Protein Biological Process 1 : Biosynthesis/Metabolism
Protein Biological Process 2 : Amino-acid biosynthesis and metabolism
Protein Biological Process 3 : Glutathione biosynthesis
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 5-7 working days
803.88 803.88 USD
Human Glutamate [NMDA] receptor subunit zeta 1(GRIN1) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Signal Transduction
Uniprot ID : Q05586
Species : Human
Former Code :
Alias : NMDA1 NMDAR1 NR1 N-methyl-D-aspartate receptor channel, subunit zeta-1|NMDA receptor 1|glutamate [NMDA] receptor subunit zeta 1
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 125 pg/ml-8000 pg/ml
Sensitivity : 31.25 pg/ml
Antigen Name : glutamate receptor, ionotropic, N-methyl D-aspartate 1
Abbreviation : GRIN1
Protein Biological Process 1 : Transport
Protein Biological Process 2 : Anion transport
Protein Biological Process 3 : Ion transport
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 5-7 working days
803.88 803.88 USD
Human Glutamate [NMDA] Receptor Subunit Epsilon 2 (NR 2) Antibody ELISA Kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Others
Uniprot ID :
Species : Human
Former Code :
Alias :
Product Type : ELISA Kit
Sample Type : serum
Detect Range :
Sensitivity :
Antigen Name : Glutamate[NMDA]Receptor Subunit Epsilon-2 Antibody(NR-2 Ab)
Abbreviation :
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
887.04 887.04 USD
Human Glutamate [NMDA] receptor subunit epsilon 1(GRIN2A) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Signal Transduction
Uniprot ID : Q12879
Species : Human
Former Code : CSB-E16271h
Alias : NMDAR2A, NR2A, N-methyl-D-aspartate receptor channel, subunit epsilon-1|N-methyl-D-aspartate receptor subunit 2A|NMDA receptor subtype 2A|OTTHUMP00000160135|OTTHUMP00000174531
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 15.6 pg/ml-1000 pg/ml
Sensitivity : 3.9 pg/ml
Antigen Name : glutamate receptor, ionotropic, N-methyl D-aspartate 2A
Abbreviation : GRIN2A
Protein Biological Process 1 : Transport
Protein Biological Process 2 : Anion transport
Protein Biological Process 3 : Ion transport
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 5-7 working days
803.88 803.88 USD
Human Glutamate receptor delta 2 subunit(GRID2) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Neuroscience
Uniprot ID : O43424
Species : Human
Former Code :
Alias : MGC117022, MGC117023, MGC117024, GluR-delta-2
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 18.75 pg/ml-1200 pg/ml
Sensitivity : 4.69 pg/ml.
Antigen Name : glutamate receptor, ionotropic, delta 2
Abbreviation : GRID2
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human Glutamate receptor 1(GRIA1) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Signal Transduction
Uniprot ID : P42261
Species : Human
Former Code :
Alias : GLUH1 GLUR1 GLURA, HBGR1 MGC133252, AMPA 1
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 23.44 pg/ml-1500 pg/ml
Sensitivity : 5.86 pg/ml
Antigen Name : glutamate receptor, ionotropic, AMPA 1
Abbreviation : GRIA1
Protein Biological Process 1 : Transport
Protein Biological Process 2 : Anion transport
Protein Biological Process 3 : Ion transport
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 5-7 working days
803.88 803.88 USD
Human Glutamate dehydrogenase 1 mitochondrial(GLUD1) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P00367
Species : Human
Former Code :
Alias : GDH, GDH1 GLUD, MGC132003, glutamate dehydrogenase (NAD(P)+)
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 9.38 µU/ml-600 µU/ml
Sensitivity : 2.34 µU/ml.
Antigen Name : glutamate dehydrogenase 1
Abbreviation : GLUD1
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human Glutamate dehydrogenase (GDH/GLDH) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : P26443
Abbreviation : GLUD1
Alternative Names : GDH; GDH1; GLUD; MGC132003; glutamate dehydrogenase (NAD(P)+)
Application : ELISA
Range : 0.156-10 ng/mL
Sensitivity : 0.065 ng/mL
Intra-AssayCV : ?6.2%
Inter-AssayCV : ?10.6%
Recovery : 0.98
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate GLUD1 in samples. An antibody specific for GLUD1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGLUD1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for GLUD1 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GLUD1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : GLUD1 (Glutamate dehydrogenase 1) is a mitochondrial matrix enzyme, with a key role in the nitrogen and glutamate (Glu) metabolism and the energy homeostasis. GLUD1 is expressed at high levels in liver, brain, pancreas and kidney, but not in muscle. In the pancreatic cells, GLUD1 is tho µght to be involved in ins µLin secretion mechanisms. In nervous tissue, where Glu is present in concentrations higher than in the other tissues, GLUD1 appears to function in both the synthesis and the catabolism of Glu and perhaps in ammonia detoxification.L-glutamate dehydrogenase (EC 1.4.1.3) has a central role in nitrogen metabolism in plants and animals. Glutamate dehydrogenase is found in all organisms and catalyzes the oxidative deamination of 1-glutamate to 2-oxoglutarate (Smith et al., 2001).
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human Glutamate decarboxylase 1(GAD1) autoantibody ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Autoimmunity
Uniprot ID :
Species : Human
Former Code :
Alias :
Product Type : ELISA Kit
Sample Type : serum, plasma
Detect Range : Request Information
Sensitivity :
Antigen Name : Glutamate decarboxylase 1(GAD1) autoantibody
Abbreviation : GAD1 autoantibody (IgG)
Protein Biological Process 1 : Autoimmunity
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-3h
Sample Volume : 50-100 µL
Detection Wavelength : 450nm
Delievery Date :
716.10 716.1 USD
Human Glutamate carboxypeptidase 2(FOLH1) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : Q04609
Species : Human
Former Code :
Alias : FGCP, FOLH, GCP2, GCPII, NAALAD1 NAALAdase, PSM, PSMA, mGCP, N-acetylated alpha-linked acidic dipeptidase 1|cell growth-inhibiting protein 27|folate hydrolase 1|folylpoly-gamma-glutamate carboxypep
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 4.7 ng/ml-300 ng/ml
Sensitivity : 1.2 ng/ml
Antigen Name : folate hydrolase (prostate-specific membrane antigen) 1
Abbreviation : FOLH1
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human GLUT4(Glucose Transporter 4) ELISA Kit
Volume : 96 Test
Species : Human
Uniprot ID : P14672
Short name : GLUT4
Alias : GLUT4|SLC2A4|Solute carrier family 2|facilitated glucose transporter member 4|Glucose transporter type 4|ins µLin-responsive|GLUT-4|GLUT-4|ins µLin-responsive glucose transporter type 4
Sensitivity : 0.188ng/ml
Range : 0.313-20ng/ml
Detection method : Sandwich ELISA, Double Antibody
Storage_tempeRature : 2-8 °C for 6 months
Research Area : Metabolism
0.01 0.01 USD
Human GLUT2(Glucose Transporter 2) ELISA Kit
Volume : 96 Test
Species : Human
Uniprot ID : P11168
Short name : GLUT2
Alias : GLUT2|SLC2A2|GLUT-2|GLUT2 Glucose transporter type 2|liver|SLC2A2|solute carrier family 2|facilitated glucose transporter|member 2|solute carrier family 2|facilitated glucose transporter member 2
Sensitivity : 0.375ng/ml
Range : 0.625-40ng/ml
Detection method : Sandwich ELISA, Double Antibody
Storage_tempeRature : 2-8 °C for 6 months
Research Area : Stem Cells, Metabolism
0.01 0.01 USD
Human GLUL(Glutamine synthetase) ELISA Kit
Volume : 96 Test
Species : Human
Uniprot ID : P15104
Short name : GL µL
Alias : GL µL|GS|GLNS|Glutamine synthetase|Glutamate--ammonia ligase
Sensitivity : 9.375pg/ml
Range : 15.625-1000pg/ml
Detection method : Sandwich ELISA, Double Antibody
Storage_tempeRature : 2-8 °C for 6 months
Research Area : Neuroscience, Cancer, Metabolism
0.01 0.01 USD
Human GLUL / Glutamine synthetase ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 15.6-1000pg/mL
Sensitivity : 9.1pg/mL
Species : Human
GeneName : GL µL
Alternative Names : GS,GLNS,Glutamate--ammonia ligase,Palmitoyltransferase GL µL
Uniport : P15104
0.01 0.01 USD
Human GLUD1(Glutamate dehydrogenase 1 mitochondrial) ELISA Kit
Volume : 96 Test
Species : Human
Uniprot ID : P00367
Short name : GLUD1
Alias : GLUD1|Glutamate dehydrogenase 1|mitochondrial|GDH 1|GLUD
Sensitivity : 0.375mIU/ml
Range : 0.625-40mIU/ml
Detection method : Sandwich ELISA, Double Antibody
Storage_tempeRature : 2-8 °C for 6 months
Research Area : Signal Transduction, Metabolism, Neuroscience
0.01 0.01 USD
Human GLUD1 / Glutamate dehydrogenase 1 mitochondrial ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 0.156-10ng/ml
Sensitivity : 0.1ng/mL
Species : Human
GeneName : GLUD1
Alternative Names : GDH 1GLUD
Uniport : P00367
0.01 0.01 USD
Human Glucosylceramidase(GBA) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P04062
Species : Human
Former Code :
Alias : GBA1 GCB, GLUC, D-glucosyl-N-acylsphingosine glucohydrolase|beta-glucocerebrosidase|glucocerebrosidase|lysosomal glucocerebrosidase
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 0.312 ng/ml-20 ng/ml
Sensitivity : 0.078 ng/ml.
Antigen Name : glucosidase, beta; acid (includes glucosylceramidase)
Abbreviation : GBA
Protein Biological Process 1 : Biosynthesis/Metabolism
Protein Biological Process 2 : Lipogenesis and lipometabolism
Protein Biological Process 3 : Lipid metabolism
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 5-7 working days
803.88 803.88 USD
Human glucose 6 phosphate isomerase GPI ELISA Kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P06744
Species : Human
Former Code : CSB-EL009717HU
Alias : AMF, GNPI, NLK, PGI, PHI, SA36, autocrine motility factor|glucose-6-phosphate isomerase|hexose monophosphate isomerase|hexosephosphate isomerase|neuroleukin|oxoisomerase|phosphoglucose isomerase|pho
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 12.5 ng/ml-800ng/ml
Sensitivity : 3.12 ng/ml
Antigen Name : glucose phosphate isomerase
Abbreviation : GPI
Protein Biological Process 1 : Angiogenesis
Protein Biological Process 2 :
Protein Biological Process 3 : Angiogenesis
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
0.01 0.01 USD
Human Glucose 6 Phosphate Dehydrogenase G6PD ELISA Kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P11413
Species : Human
Former Code : CSB-EL009121HU
Alias : G6PD1 glucose-6-phosphate 1-dehydrogenase|glucose-6-phosphate dehydrogenase, G6PD
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 6.25 mU/ml-400 mU/ml
Sensitivity : 1.56mU/ml
Antigen Name : glucose-6-phosphate dehydrogenase
Abbreviation : G6PD
Protein Biological Process 1 : Biosynthesis/Metabolism
Protein Biological Process 2 : glyconeogenesis and glycometabolism
Protein Biological Process 3 : Carbohydrate metabolism
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
887.04 887.04 USD
Human Glucose 6 phosphatase (G 6 Pase) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : P35575
Abbreviation : G6PC
Alternative Names : G6PT; GSD1; GSD1a; MGC163350;
Application : ELISA
Range : 78.1-5000 mIU/mL
Sensitivity : 39 mlU/mL
Intra-AssayCV : ?6.5%
Inter-AssayCV : ?9.2%
Recovery : 1.05
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate G6PC in samples. An antibody specific for G6PC has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyG6PC present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for G6PC is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of G6PC bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : Fibroblast growth factor 6 is a protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. FGF family members possess broad mitogenic and cell survival activities, and are involved in a variety of biological processes, including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. This gene displayed oncogenic transforming activity when transfected into mammalian cells. The mouse homolog of this gene exhibits a restricted expression profile predominantly in the myogenic lineage, which s µggested a role in muscle regeneration or differentiation.Marics et al. (1989) showed that the cloned normal FGF6 gene transformed mouse NIH 3T3 fibroblasts using both focus and tumorigenicity assays.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human Glucose transporter 4 (GLUT4) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : P14672
Abbreviation : SLC2A4
Alternative Names : GLUT4; glucose transporter 4|ins µLin-responsive glucose transporter type 4
Application : ELISA
Range : 0.312-20 ng/mL
Sensitivity : 0.115 ng/mL
Intra-AssayCV : ?6.8%
Inter-AssayCV : ?11.6%
Recovery : 1.09
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate SLC2A4 in samples. An antibody specific for SLC2A4 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anySLC2A4 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for SLC2A4 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of SLC2A4 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : GLUT4 is the ins µLin-reg µLated glucose transporter found in adipose tissues and striated muscle (skeletal and cardiac) that is responsible for ins µLin-reg µLated glucose disposal.In the absence of ins µLin, GLUT4 is sequestered in the interior of muscle and fat cells within lipid bilayers of vesicles. Ins µLin induces the translocation of GLUT4 from intracell µLar storage sites to the plasma membrane. Ins µLin binds to the ins µLin receptor in its dimeric form. The receptor phosphorylates and subsequently activates IRS-1 which converts PIP2 to PIP3. PIP3 is bound to PKB (protein kinase B), signaling for PDK1 to phosphorylate PKB. Once phosphorylated, PKB is in its active form and phosphorylates other targets that stim µLate GLUT4 to be expressed on the plasma membrane.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
897.60 897.6 USD
Human Glucose transporter 3 (GLUT3) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : P11169
Abbreviation : SLC2A3
Alternative Names : FLJ90380; GLUT3; glucose transporter type 3; brain|solute carrier family 2; member 3
Application : ELISA
Range : 0.781-50 ng/mL
Sensitivity : 0.29 ng/mL
Intra-AssayCV : ?4.1%
Inter-AssayCV : ?7.9%
Recovery : 0.98
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate SLC2A3 in samples. An antibody specific for SLC2A3 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anySLC2A3 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for SLC2A3 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of SLC2A3 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : GLUT3 is a high-affinity isoform of Type I glucose transporter expressed mostly in neurons where it is believed to be the main glucose transporter isoform, and in the placenta. GLUTs are integral membrane proteins which contain 12 membrane spanning helices with both the amino and carboxyl termini exposed on the cytoplasmic side of the plasma membrane. GLUT proteins transport glucose and related hexoses according to a model of alternate conformation, which predicts that the transporter exposes a single substrate binding site toward either the outside or the inside of the cell. Binding of glucose to one site provokes a conformational change associated with transport, and releases glucose to the other side of the membrane.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human glucose transporter 1(GLUT1) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Signal Transduction
Uniprot ID : P11166
Species : Human
Former Code : CSB-EL021546HU
Alias : DYT17, DYT18, GLUT, GLUT1 MGC141895, MGC141896, PED
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 9.4 pg/ml-600 pg/ml
Sensitivity : 2.35 pg/ml
Antigen Name : solute carrier family 2 (facilitated glucose transporter), member 1
Abbreviation : SLC2A1
Protein Biological Process 1 : Transport
Protein Biological Process 2 :
Protein Biological Process 3 : S µgar transport
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 5-7 working days
0.01 0.01 USD
Human Glucose transporter 1 (GLUT1) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : P13866
Abbreviation : SLC5A1
Alternative Names : RP1-127L4.1; D22S675; NAGT; SGLT1; Human Na+/glucose cotransporter 1 mRNA; complete cds|sodium/glucose cotransporter 1|solute carrier family 5 (sodium/glucose transporter); member 1|solute carrier f
Application : ELISA
Range : 0.312-20 ng/mL
Sensitivity : 0.116 ng/mL
Intra-AssayCV : ?4.3%
Inter-AssayCV : ?7.5%
Recovery : 0.97
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate SLC5A1 in samples. An antibody specific for SLC5A1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anySLC5A1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for SLC5A1 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of SLC5A1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : GLUT1 facilitates the transport of glucose across the plasma membranes of mammalian cells.GLUT1 is responsible for the low-level of basal glucose uptake required to sustain respiration in all cells. Expression levels of GLUT1 in cell membranes are increased by reduced glucose levels and decreased by increased glucose levels. GLUT1 is also a major receptor for take-up of Vitamin C as well as glucose, especially in non vitamin C producing mammals as part of an adaptation to compensate by participating in a Vitamin C recycling process. In mammals that do produce Vitamin C, GLUT4 is often expressed instead of GLUT1.GLUT1 behaves as a Michaelis-Menten enzyme and contains 12 membrane-spanning alpha helices, each containing 20 amino acid residues.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human Glucose dependent insulin releasing polypeptide GIP ELISA Kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Signal Transduction
Uniprot ID : P09681
Species : Human
Former Code : CSB-EL009434HU
Alias : gastric inhibitory polypeptide, glucose-dependent ins µLinotropic polypeptide
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 11.43 ng/ml-200 ng/ml
Sensitivity : 7.14 ng/ml
Antigen Name : gastric inhibitory polypeptide
Abbreviation : GIP
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
803.88 803.88 USD
Human Glucosamine 6 phosphate isomerase 2 (GNPDA2) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : Q8TDQ7
Abbreviation : GNPDA2
Alternative Names : SB52; 4921523I18Rik|glucosamine-6-phosphate isomerase|putative glucosamine-6-phosphate isomerase
Application : ELISA
Range : 0.31-20 ng/mL
Sensitivity : 0.156 ng/mL
Intra-AssayCV : ?4.5%
Inter-AssayCV : ?8.6%
Recovery : 0.89
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate GNPDA2 in samples. An antibody specific for GNPDA2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGNPDA2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for GNPDA2 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GNPDA2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview :
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
805.20 805.2 USD
Human glucokinase GCK ELISA Kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P35557
Species : Human
Former Code : CSB-EL009319HU
Alias : GK, GLK, HHF3, HK4, HKIV, HXKP, MODY2, ATP : D-hexose 6-phosphotransferase|glucokinase|hexokinase D, pancreatic isozyme
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 64 pg/ml-1000 pg/ml
Sensitivity : 22 pg/ml
Antigen Name : glucokinase (hexokinase 4)
Abbreviation : GCK
Protein Biological Process 1 : Biosynthesis/Metabolism
Protein Biological Process 2 : glyconeogenesis and glycometabolism
Protein Biological Process 3 : Glycolysis
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
0.01 0.01 USD
Human Glucokinase regulatory protein (GKRP) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : Q14397
Abbreviation : GCKR
Alternative Names : GKRP; glucokinase (hexokinase 4) reg µLatory protein|glucokinase reg µLator|glucokinase reg µLatory protein|hexokinase 4
Application : ELISA
Range : 31.25-2000 pg/mL
Sensitivity : 15.9 pg/mL
Intra-AssayCV : ?6.6%
Inter-AssayCV : ?10.2%
Recovery : 0.84
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate GCKR in samples. An antibody specific for GCKR has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGCKR present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for GCKR is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GCKR bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview :
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
897.60 897.6 USD
Human glucocorticoid receptor β GR β ELISA Kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Epigenetics and Nuclear Signaling
Uniprot ID :
Species : Human
Former Code :
Alias :
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates and cell lysates
Detect Range : 39 pg/ml-2500 pg/ml
Sensitivity : 9.75 pg/ml
Antigen Name : glucocorticoid receptor-β,GR-β
Abbreviation : GR-β
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
887.04 887.04 USD
Human Glucocorticoid receptor(NR3C1) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Epigenetics and Nuclear Signaling
Uniprot ID : P04150
Species : Human
Former Code : CSB-E08886h
Alias : GCCR, GCR, GR, GRL, glucocorticoid receptor
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 31.25 pg/ml-2000 pg/ml
Sensitivity : 7.81 pg/ml
Antigen Name : nuclear receptor subfamily 3, group C, member 1 (glucocorticoid receptor)
Abbreviation : NR3C1
Protein Biological Process 1 : Transcription/Transcription reg µLation
Protein Biological Process 2 :
Protein Biological Process 3 : Transcription
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 5-7 working days
803.88 803.88 USD
Human Glucocorticoid (GC) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : N/A
Abbreviation : GC
Alternative Names : DBP; DBP/GC; GRD3; VDBG; VDBP; vitamin D-binding alpha-glob µLin|vitamin D-binding protein
Application : ELISA
Range : 18.52-1500 pg/mL
Sensitivity : 7.54 pg/mL
Intra-AssayCV : ?4.0%
Inter-AssayCV : ?7.8%
Recovery : 0.99
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate GC in samples. An antibody specific for GC has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGC present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for GC is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GC bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : Glucagon has a major role in maintaining normal concentrations of glucose in blood, and is often described as having the opposite effect of ins µLin. That is, glucagon has the effect of increasing blood glucose levels. Glucagon is a linear peptide of 29 amino acids. Its primary sequence is almost perfectly conserved among vertebrates, and it is structurally related to the secretin family of peptide hormones. Glucagon is syntheVolumed as proglucagon and proteolytically processed to yield glucagon within alpha cells of the pancreatic islets. Proglucagon is also expressed within the intestinal tract, where it is processed not into glucagon, but to a family of glucagon-like peptides (enteroglucagon).
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
0.01 0.01 USD
Human glucagon like peptide 1 GLP 1 ELISA Kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID :
Species : Human
Former Code :
Alias : N/A
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 2.3 ng/ml-40 ng/ml
Sensitivity : 1.4 ng/ml
Antigen Name : glucagon-like peptide-1GLP-1
Abbreviation : GLP-1
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
0.01 0.01 USD
Human glucagon like peptide 1 receptor (GLP1R) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Cardiovasc µLar
Uniprot ID : P43220
Species : Human
Former Code : CSB-EL009514HU
Alias : MGC138331
Product Type : ELISA Kit
Sample Type : serum, plasma
Detect Range : 0.156 ng/ml-10 ng/ml
Sensitivity : 0.039 ng/ml
Antigen Name : glucagon-like peptide 1 receptor
Abbreviation : GLP1R
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
0.01 0.01 USD
Human Glucagon receptor(GCGR) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Metabolism
Uniprot ID : P47871
Species : Human
Former Code :
Alias : FLJ97182, GGR, MGC138246,
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 31.2 pg/ml-2000 pg/ml
Sensitivity : 7.8 pg/ml
Antigen Name : glucagon receptor
Abbreviation : GCGR
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD
Human Glucagon like peptide 2 (GLP2) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : N/A
Abbreviation : GLP2
Alternative Names : N/A
Application : ELISA
Range : 123.5-10000 pg/mL
Sensitivity : 52.1 pg/mL
Intra-AssayCV : ?6.0%
Inter-AssayCV : ?10.1%
Recovery : 1.09
Sample Type : Serum, Plasma, Other biological fluids
Detection Method : Sandwich
Analysis Method?? : Quantitive
Test principle : This assay employs a two-site sandwich ELISA to quantitate GLP2 in samples. An antibody specific for GLP2 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and anyGLP2 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conj µgated antibody specific for GLP2 is added to the wells. After washing, Streptavidin conj µgated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of GLP2 bound in the initial step. The color development is stopped and the intensity of the color is measured.
Product Overview : GLP-2 is a 33 amino acid peptide with the sequence HADGSFSDEMNTILDNLAARDFINWLIQTKITD in humans. GLP-2 is created by specific post-translational proteolytic cleavage of proglucagon in a process that also liberates the related glucagon-like peptide-1 (GLP-1). GLP-2 is produced by the intestinal endocrine L cell and by various neurons in the central nervous system. Intestinal GLP-2 is co-secreted along with GLP-1 upon nutrient ingestion. When externally administered, GLP-2 produces a number of effects in humans and rodents, including intestinal growth, enhancement of intestinal function, reduction in bone breakdown and neuroprotection. GLP-2 may act in an endocrine fashion to link intestinal growth and metabolism with nutrient intake. GLP-2 and related analogs may be treatments for short bowel syndrome, Crohn's disease, osteoporosis and as adjuvant therapy during cancer chemotherapy.
Stability : The stability of ELISA kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. The loss rate was determined by accelerated thermal degradation test. Keep the kit at 37°C for 4 and 7 days, and compare O.D.values of the kit kept at 37°C with that of at recommended temperature. (referring from China Biological Products Standard, which was calc µLated by the Arrhenius equation. For ELISA kit, 4 days storage at 37°C can be considered as 6 months at 2 - 8°C, which means 7 days at 37°C equaling 12 months at 2 - 8°C).
805.20 805.2 USD
Human Glucagon (GC) ELISA Kit
Species Reactivity : Human (Homo sapiens)
UniProt : P01275
Abbreviation : GCG
Alternative Names : GLP1; GLP2; GRPP; glicentin-related polypeptide|glucagon-like peptide 1|glucagon-like peptide 2
Application :
Range : Request Information
Sensitivity : Request Information
Intra-AssayCV :
Inter-AssayCV :
Recovery :
Sample Type : Serum, Plasma, Other biological fluids
Detection Method :
Analysis Method?? :
Test principle :
Product Overview :
Stability :
897.60 897.6 USD
Human GLT25D1(Procollagen galactosyltransferase 1) ELISA Kit
Volume : 96 Test
Species : Human
Uniprot ID : Q8NBJ5
Short name : GLT25D1
Alias : GLT25D1|Procollagen galactosyltransferase 1|Hydroxylysine galactosyltransferase 1|Glycosyltransferase 25 family member 1
Sensitivity : 0.094ng/ml
Range : 0.156-10ng/ml
Detection method : Sandwich ELISA, Double Antibody
Storage_tempeRature : 2-8 °C for 6 months
Research Area : Signal Transduction
0.01 0.01 USD
Human GLS2 / Glutaminase liver isoform mitochondrial ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 78-5000pg/mL
Sensitivity : 39.4pg/mL
Species : Human
GeneName : GLS2
Alternative Names : GLS,L-glutaminase,L-glutamine amidohydrolase,GA
Uniport : Q9UI32
0.01 0.01 USD
Human GLS(Glutaminase kidney isoform mitochondrial) ELISA Kit
Volume : 96 Test
Species : Human
Uniprot ID : O94925
Short name : GLS
Alias : GLS|Glutaminase kidney isoform|mitochondrial|GLS|K-glutaminase|L-glutamine amidohydrolase|GLS1
Sensitivity : 0.188ng/ml
Range : 0.313-20ng/ml
Detection method : Sandwich ELISA, Double Antibody
Storage_tempeRature : 2-8 °C for 6 months
Research Area : Neuroscience, Metabolism
0.01 0.01 USD
Human GLS / Glutaminase kidney isoform mitochondrial ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 0.312-20ng/mL
Sensitivity : 0.098ng/ml
Species : Human
GeneName : GLS
Alternative Names : GLS,K-glutaminase,L-glutamine amidohydrolase,GLS1KIAA0838
Uniport : O94925
0.01 0.01 USD
Human GLRX5 / Glutaredoxin related protein 5 mitochondrial ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 15.6-1000pg/mL
Sensitivity : 7.85pg/mL
Species : Human
GeneName : GLRX5
Alternative Names : Monothiol glutaredoxin-5,C14orf87
Uniport : Q86SX6
0.01 0.01 USD
Human GLRX3(Glutaredoxin 3) ELISA Kit
Volume : 96 Test
Species : Human
Uniprot ID : O76003
Short name : GLRX3
Alias : GLRX3|Glutaredoxin-3|Glutaredoxin 3|GLRX4|GRX3|GRX4|PICOT|TXNL2
Sensitivity : 0.094ng/ml
Range : 0.156-10ng/ml
Detection method : Sandwich ELISA, Double Antibody
Storage_tempeRature : 2-8 °C for 6 months
Research Area : Metabolism
0.01 0.01 USD
Human GLRX3 / Glutaredoxin 3 ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 0.312-20ng/mL
Sensitivity : 0.12ng/mL
Species : Human
GeneName : GLRX3
Alternative Names : PKC-interacting cousin of thioredoxin,PICOT,PKC-theta-interacting protein,PKCq-interacting protein,Thioredoxin-like protein 2,PICOT,TXNL2,HUSSY-22
Uniport : O76003
0.01 0.01 USD
Human GLRX2 / Glutaredoxin 2 mitochondrial ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 0.156-10ng/mL
Sensitivity : 0.044ng/mL
Species : Human
GeneName : GLRX2
Alternative Names : GRX2,CGI-133
Uniport : Q9NS18
0.01 0.01 USD
Human GLRX / Glutaredoxin 1 ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 0.156-10ng/mL
Sensitivity : 0.088ng/mL
Species : Human
GeneName : GLRX
Alternative Names : Thioltransferase-1TTase-1GRX
Uniport : P35754
0.01 0.01 USD
Human GLP2R / Glucagon like peptide 2 receptor ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type :
Detection Range :
Sensitivity :
Species : Human
GeneName : GLP2R
Alternative Names : GLP-2 receptor
Uniport : O95838
0.01 0.01 USD
Human GLP2(Glucagon Like Peptide 2) ELISA Kit
Volume : 96 Test
Species : Human
Uniprot ID : P01275
Short name : GLP2
Alias : GLP2|glucagon-like peptide 2
Sensitivity : 0.094ng/ml
Range : 0.156-10ng/ml
Detection method : Sandwich ELISA, Double Antibody
Storage_tempeRature : 2-8 °C for 6 months
Research Area : Signal Transduction, Metabolism, Immunology, Cancer, Neuroscience, Stem Cells
0.01 0.01 USD
Human GLP1R(Glucagon like peptide 1 receptor) ELISA Kit
Volume : 96 Test
Species : Human
Uniprot ID : P43220
Short name : GLP1R
Alias : GLP1R|Glucagon-like peptide 1 receptor|GLP-1 receptor|GLP-1R|GLP-1-R
Sensitivity : 0.094ng/ml
Range : 0.156-10ng/ml
Detection method : Sandwich ELISA, Double Antibody
Storage_tempeRature : 2-8 °C for 6 months
Research Area : Signal Transduction, Metabolism, Immunology, Cancer, Neuroscience, Stem Cells
0.01 0.01 USD
Human GLP1R / Glucagon like peptide 1 receptor ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 0.156-10ng/mL
Sensitivity : 0.1ng/mL
Species : Human
GeneName : GLP1R
Alternative Names : GLP-1 receptor
Uniport : P43220
0.01 0.01 USD
Human GLP1(Glucagon like peptide 1) ELISA Kit
Volume : 96 Test
Species : Human
Uniprot ID : P01275
Short name : GLP1
Alias : GLP-1|Glucagon Like Peptide 1|GLP1|GRPP
Sensitivity : 0.188ng/ml
Range : 0.313-20ng/ml
Detection method : Sandwich ELISA, Double Antibody
Storage_tempeRature : 2-8 °C for 6 months
Research Area : Signal Transduction, Metabolism, Immunology, Cancer, Neuroscience, Stem Cells
0.01 0.01 USD
Human GLP1 / Glucagon like peptide 1 ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 15.6-1000pg/mL
Sensitivity : 8.2pg/mL
Species : Human
GeneName : GLP1
Alternative Names :
Uniport :
0.01 0.01 USD
Human glomerular basement membrane (GBM)antibody ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Others
Uniprot ID :
Species : Human
Former Code :
Alias : N/A
Product Type : ELISA Kit
Sample Type : serum
Detect Range : Request Information
Sensitivity : Request Information
Antigen Name : glomer µLar basement membrane antibogy,GBM
Abbreviation : GBM
Protein Biological Process 1 : N/A
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 3-5 working days
0.01 0.01 USD
Human GLOD4 / Glyoxalase domain containing protein 4 ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type :
Detection Range :
Sensitivity :
Species : Human
GeneName : GLOD4
Alternative Names : C17orf25,CGI-150,My027
Uniport : Q9HC38
0.01 0.01 USD
Human GLO1 / Lactoylglutathione lyase ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 78-5000pg/mL
Sensitivity : 32pg/ml
Species : Human
GeneName : GLO1
Alternative Names : Aldoketomutase,Glyoxalase I,Glx I,Ketone-aldehyde mutase,Methylglyoxalase,S-D-lactoylglutathione methylglyoxal lyase
Uniport : Q04760
0.01 0.01 USD
Human GLIPR1 like protein 1(GLIPR1L1) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Developmental Biology
Uniprot ID : Q6UWM5
Species : Human
Former Code :
Alias : ALKN2972, MGC26856, PRO7434,
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 0.156 ng/ml-10 ng/ml
Sensitivity : 0.039 ng/ml.
Antigen Name : GLI pathogenesis-related 1 like 1
Abbreviation : GLIPR1L1
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
0.01 0.01 USD
Human GLIPR1(Glioma pathogenesis related protein 1) ELISA Kit
Volume : 96 Test
Species : Human
Uniprot ID : P48060
Short name : GLIPR1
Alias : GLIPR1|GLI pathogenesis-related 1|GLI pathogenesis-related 1|glioma|GliPR|GliPR 1|GLIPRglioma pathogenesis-related protein 1|Protein RTVP-1|related to testis-specific|vespid|and pathogenesis proteins 1|RTVP1CRISP7|testes-specific vespid and pathogenesis protein 1
Sensitivity : 18.75pg/ml
Range : 31.25-2000pg/ml
Detection method : Sandwich ELISA, Double Antibody
Storage_tempeRature : 2-8 °C for 6 months
Research Area :
0.01 0.01 USD
Human GLIPR1 / Glioma pathogenesis related protein 1 ELISA Kit
Volume : 96-test Kit. Other Volumes are also available. Please contact us.
Assay Type : Sandwich
Detection Range : 31.2-2000pg/mL
Sensitivity : 5.9pg/mL
Species : Human
GeneName : GLIPR1
Alternative Names : GliPR 1Protein RTVP-1GLIPR,RTVP1
Uniport : P48060
0.01 0.01 USD
Human Gliomedin(GLDN) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Neuroscience
Uniprot ID : Q6ZMI3
Species : Human
Former Code :
Alias : CLOM, COLM, CRG-L2, CRGL2, FLJ23917, UNC-112, collomin|colmedin
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates, cell lysates
Detect Range : 0.156 ng/ml-10 ng/ml
Sensitivity : 0.039ng/ml
Antigen Name : gliomedin
Abbreviation : GLDN
Protein Biological Process 1 : Developmental Protein
Protein Biological Process 2 :
Protein Biological Process 3 : Differentiation
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 5-7 working days
803.88 803.88 USD
Human Glioma pathogenesis related protein 1(GLIPR1) ELISA kit
Volume : 96 Tests. Other Volumes are also available. Please Inquire.
Research topic : Cancer
Uniprot ID : P48060
Species : Human
Former Code :
Alias : CRISP7, GLIPR, RTVP1 GLI pathogenesis-related 1 (glioma)|glioma pathogenesis-related protein 1|related to testis-specific, vespid, and pathogenesis proteins 1|testes-specific vespid and pathogenesi
Product Type : ELISA Kit
Sample Type : serum, plasma, tissue homogenates
Detect Range : 39 pg/ml-2500 pg/ml
Sensitivity : 9.75 pg/ml
Antigen Name : GLI pathogenesis-related 1
Abbreviation : GLIPR1
Protein Biological Process 1 :
Protein Biological Process 2 :
Protein Biological Process 3 :
Assay Time : 1-5h
Sample Volume : 50-100 µL
Detection Wavelength : 450 nm
Delievery Date : 7-14 working days
803.88 803.88 USD